/snap/core22/2437/usr/lib/python3.10/__pycache__
NameSizeModeActions
abc.cpython-310.pyc67510644editdlrm
aifc.cpython-310.pyc246850644editdlrm
antigravity.cpython-310.pyc8220644editdlrm
argparse.cpython-310.pyc635390644editdlrm
ast.cpython-310.pyc557390644editdlrm
asynchat.cpython-310.pyc70250644editdlrm
asyncore.cpython-310.pyc160020644editdlrm
base64.cpython-310.pyc171620644editdlrm
bdb.cpython-310.pyc258320644editdlrm
binhex.cpython-310.pyc128700644editdlrm
bisect.cpython-310.pyc25880644editdlrm
bz2.cpython-310.pyc108700644editdlrm
calendar.cpython-310.pyc263030644editdlrm
cgi.cpython-310.pyc267230644editdlrm
cgitb.cpython-310.pyc99980644editdlrm
chunk.cpython-310.pyc48600644editdlrm
cmd.cpython-310.pyc127070644editdlrm
code.cpython-310.pyc99570644editdlrm
codecs.cpython-310.pyc332190644editdlrm
codeop.cpython-310.pyc55950644editdlrm
colorsys.cpython-310.pyc32650644editdlrm
compileall.cpython-310.pyc127330644editdlrm
configparser.cpython-310.pyc454580644editdlrm
contextlib.cpython-310.pyc208950644editdlrm
contextvars.cpython-310.pyc2460644editdlrm
copy.cpython-310.pyc69960644editdlrm
copyreg.cpython-310.pyc46830644editdlrm
cProfile.cpython-310.pyc51130644editdlrm
crypt.cpython-310.pyc35500644editdlrm
csv.cpython-310.pyc117980644editdlrm
dataclasses.cpython-310.pyc265780644editdlrm
datetime.cpython-310.pyc565330644editdlrm
decimal.cpython-310.pyc3620644editdlrm
difflib.cpython-310.pyc589050644editdlrm
dis.cpython-310.pyc156560644editdlrm
doctest.cpython-310.pyc761750644editdlrm
enum.cpython-310.pyc260630644editdlrm
filecmp.cpython-310.pyc87490644editdlrm
fileinput.cpython-310.pyc140720644editdlrm
fnmatch.cpython-310.pyc42440644editdlrm
fractions.cpython-310.pyc186000644editdlrm
ftplib.cpython-310.pyc289770644editdlrm
functools.cpython-310.pyc283350644editdlrm
genericpath.cpython-310.pyc39070644editdlrm
getopt.cpython-310.pyc63390644editdlrm
getpass.cpython-310.pyc42100644editdlrm
gettext.cpython-310.pyc182210644editdlrm
glob.cpython-310.pyc58520644editdlrm
graphlib.cpython-310.pyc76160644editdlrm
gzip.cpython-310.pyc185460644editdlrm
hashlib.cpython-310.pyc68450644editdlrm
heapq.cpython-310.pyc138650644editdlrm
hmac.cpython-310.pyc69730644editdlrm
imaplib.cpython-310.pyc423120644editdlrm
imghdr.cpython-310.pyc39050644editdlrm
imp.cpython-310.pyc97860644editdlrm
inspect.cpython-310.pyc851530644editdlrm
io.cpython-310.pyc36630644editdlrm
ipaddress.cpython-310.pyc626700644editdlrm
keyword.cpython-310.pyc9270644editdlrm
linecache.cpython-310.pyc41420644editdlrm
locale.cpython-310.pyc461540644editdlrm
lzma.cpython-310.pyc121000644editdlrm
mailbox.cpython-310.pyc600910644editdlrm
mailcap.cpython-310.pyc73200644editdlrm
mimetypes.cpython-310.pyc176190644editdlrm
modulefinder.cpython-310.pyc161660644editdlrm
netrc.cpython-310.pyc39330644editdlrm
nntplib.cpython-310.pyc316230644editdlrm
ntpath.cpython-310.pyc147040644editdlrm
nturl2path.cpython-310.pyc17470644editdlrm
numbers.cpython-310.pyc118660644editdlrm
opcode.cpython-310.pyc54470644editdlrm
operator.cpython-310.pyc135080644editdlrm
optparse.cpython-310.pyc477540644editdlrm
os.cpython-310.pyc315990644editdlrm
pathlib.cpython-310.pyc420520644editdlrm
pdb.cpython-310.pyc474400644editdlrm
pickle.cpython-310.pyc468820644editdlrm
pickletools.cpython-310.pyc677600644editdlrm
pipes.cpython-310.pyc77690644editdlrm
pkgutil.cpython-310.pyc183610644editdlrm
platform.cpython-310.pyc274290644editdlrm
plistlib.cpython-310.pyc237650644editdlrm
poplib.cpython-310.pyc135730644editdlrm
posixpath.cpython-310.pyc105600644editdlrm
pprint.cpython-310.pyc178750644editdlrm
profile.cpython-310.pyc143910644editdlrm
pstats.cpython-310.pyc236210644editdlrm
pty.cpython-310.pyc41430644editdlrm
pyclbr.cpython-310.pyc97750644editdlrm
pydoc.cpython-310.pyc856450644editdlrm
py_compile.cpython-310.pyc73390644editdlrm
queue.cpython-310.pyc107920644editdlrm
quopri.cpython-310.pyc57940644editdlrm
random.cpython-310.pyc227480644editdlrm
re.cpython-310.pyc142270644editdlrm
reprlib.cpython-310.pyc52500644editdlrm
rlcompleter.cpython-310.pyc59540644editdlrm
runpy.cpython-310.pyc94110644editdlrm
sched.cpython-310.pyc61150644editdlrm
secrets.cpython-310.pyc21750644editdlrm
selectors.cpython-310.pyc171050644editdlrm
shelve.cpython-310.pyc94920644editdlrm
shlex.cpython-310.pyc77820644editdlrm
shutil.cpython-310.pyc385360644editdlrm
signal.cpython-310.pyc29350644editdlrm
site.cpython-310.pyc179220644editdlrm
sitecustomize.cpython-310.pyc2250644editdlrm
smtpd.cpython-310.pyc261470644editdlrm
smtplib.cpython-310.pyc357660644editdlrm
sndhdr.cpython-310.pyc69620644editdlrm
socket.cpython-310.pyc289630644editdlrm
socketserver.cpython-310.pyc253470644editdlrm
sre_compile.cpython-310.pyc151940644editdlrm
sre_constants.cpython-310.pyc63570644editdlrm
sre_parse.cpython-310.pyc217550644editdlrm
ssl.cpython-310.pyc452710644editdlrm
stat.cpython-310.pyc42730644editdlrm
statistics.cpython-310.pyc370510644editdlrm
string.cpython-310.pyc71020644editdlrm
stringprep.cpython-310.pyc170750644editdlrm
struct.cpython-310.pyc3070644editdlrm
subprocess.cpython-310.pyc447410644editdlrm
sunau.cpython-310.pyc164820644editdlrm
symtable.cpython-310.pyc128350644editdlrm
sysconfig.cpython-310.pyc181510644editdlrm
tabnanny.cpython-310.pyc69500644editdlrm
tarfile.cpython-310.pyc706740644editdlrm
telnetlib.cpython-310.pyc185060644editdlrm
tempfile.cpython-310.pyc273390644editdlrm
textwrap.cpython-310.pyc138120644editdlrm
this.cpython-310.pyc12640644editdlrm
threading.cpython-310.pyc449690644editdlrm
timeit.cpython-310.pyc117690644editdlrm
token.cpython-310.pyc27380644editdlrm
tokenize.cpython-310.pyc171940644editdlrm
trace.cpython-310.pyc198700644editdlrm
traceback.cpython-310.pyc217120644editdlrm
tracemalloc.cpython-310.pyc175250644editdlrm
tty.cpython-310.pyc10790644editdlrm
turtle.cpython-310.pyc1288570644editdlrm
types.cpython-310.pyc95250644editdlrm
typing.cpython-310.pyc852770644editdlrm
uu.cpython-310.pyc38670644editdlrm
uuid.cpython-310.pyc224980644editdlrm
warnings.cpython-310.pyc136460644editdlrm
wave.cpython-310.pyc175940644editdlrm
weakref.cpython-310.pyc203430644editdlrm
webbrowser.cpython-310.pyc170000644editdlrm
xdrlib.cpython-310.pyc78800644editdlrm
zipapp.cpython-310.pyc60130644editdlrm
zipfile.cpython-310.pyc618450644editdlrm
zipimport.cpython-310.pyc170330644editdlrm
_aix_support.cpython-310.pyc28790644editdlrm
_bootsubprocess.cpython-310.pyc22940644editdlrm
_collections_abc.cpython-310.pyc329250644editdlrm
_compat_pickle.cpython-310.pyc58720644editdlrm
_compression.cpython-310.pyc45120644editdlrm
_distutils_system_mod.cpython-310.pyc54220644editdlrm
_markupbase.cpython-310.pyc75720644editdlrm
_osx_support.cpython-310.pyc115350644editdlrm
_pydecimal.cpython-310.pyc1577360644editdlrm
_pyio.cpython-310.pyc736540644editdlrm
_py_abc.cpython-310.pyc46830644editdlrm
_sitebuiltins.cpython-310.pyc35470644editdlrm
_strptime.cpython-310.pyc159450644editdlrm
_sysconfigdata__linux_x86_64-linux-gnu.cpython-310.pyc353850644editdlrm
_sysconfigdata__x86_64-linux-gnu.cpython-310.pyc353790644editdlrm
_threading_local.cpython-310.pyc65390644editdlrm
_weakrefset.cpython-310.pyc76080644editdlrm
__future__.cpython-310.pyc41310644editdlrm
__phello__.foo.cpython-310.pyc1300644editdlrm
Edit: /snap/core22/2437/usr/lib/python3.10/__pycache__/inspect.cpython-310.pyc (85153B)
o p̦i @sdZdZddlZddlZddlZddlZddlZddlZ ddl Z ddl Z ddl Z ddl Z ddlZddlZddlZddlZddlZddlZddlZddlmZddlmZmZeZejD] \ZZeede<q^dZdddd d d Z d d Z!ddZ"ddZ#ddZ$ddZ%e&edrddZ'nddZ'e&edrddZ(nddZ(ddZ)d d!Z*d"d#Z+d$d%Z,d&d'Z-d(d)Z.d*d+Z/d,d-Z0d.d/Z1d0d1Z2d2d3Z3d4d5Z4d6d7Z5d8d9Z6d:d;Z7ddd?Z9d@dAZ:dBdCZ;ddDdEdFZdKdLZ?dMdNZ@dOdPZAdQdRZBdSdTZCdUdVZDddWdXZEiZFiZGddYdZZHGd[d\d\eIZJGd]d^d^ejKZLd_d`ZMdadbZNGdcddddeIZOGdedfdfZPdgdhZQdidjZRdkdlZSdmdnZTddodpZUedqdrZVdsdtZWedudvZXdwdxZYedydzZZd{d|Z[ed}d~Z\ddZ]dddZ^ddZ_ddddiie`dddddddde^f ddZae`ddddddfddZbddZcddZdddZeeddZfddZgeddZhdddZiddZjeddehjkZldddZmdddZnddZodddZpdddZqerZsddZtddZuddZvddZwddZxesfddZydZzdZ{dZ|dZ}ddZ~dd„ZdZdZdZdZddȄZddʄZeejZeejZeejdZeeeejfZdd̈́ZdddτZddфZddӄZddՄZddׄZddلZddd܄ZdddބZ dddZddddddddZGdddZGdddZGdddejZejZejZejZejZejZededededediZGdddZGdddZGdddZdddddddZddZedkredSdS(aFGet useful information from live Python objects. This module encapsulates the interface provided by the internal special attributes (co_*, im_*, tb_*, etc.) in a friendlier fashion. It also provides some help for examining source code and class layout. Here are some of the useful functions provided by this module: ismodule(), isclass(), ismethod(), isfunction(), isgeneratorfunction(), isgenerator(), istraceback(), isframe(), iscode(), isbuiltin(), isroutine() - check object types getmembers() - get members of an object that satisfy a given condition getfile(), getsourcefile(), getsource() - find an object's source code getdoc(), getcomments() - get documentation on an object getmodule() - determine the module that an object came from getclasstree() - arrange classes so as to represent their hierarchy getargvalues(), getcallargs() - get info about function arguments getfullargspec() - same, with support for Python 3 features formatargvalues() - format an argument spec getouterframes(), getinnerframes() - get info about frames currentframe() - get the current stack frame stack(), trace() - get info about frames on the stack or in a traceback signature() - get a Signature object for the callable get_annotations() - safely compute an object's annotations )zKa-Ping Yee z'Yury Selivanov N) attrgetter) namedtuple OrderedDictCO_iFglobalslocalseval_strc st|trEt|dd}|r!t|dr!|dd}t|tjr d}nd}d}t|dd}|rs z#get_annotations..)rtypegetattrhasattrr typesGetSetDescriptorTypesysmodulesdictvars ModuleTypecallable TypeError ValueErrorr functoolspartialfuncritems) objrrr obj_dictann obj_globals module_namemodule obj_localsunwrap return_valuerrrget_annotationsBsl -                r4cC t|tjS)zReturn true if the object is a module. Module objects provide these attributes: __cached__ pathname to byte compiled file __doc__ documentation string __file__ filename (missing for built-in modules))rrr#objectrrrismodule r8cC t|tS)zReturn true if the object is a class. Class objects provide these attributes: __doc__ documentation string __module__ name of module in which this class was defined)rrr6rrrisclass r;cCr5)a_Return true if the object is an instance method. Instance method objects provide these attributes: __doc__ documentation string __name__ name with which this method was defined __func__ function object containing implementation of method __self__ instance to which this method is bound)rr MethodTyper6rrrismethod r>cCs:t|s t|s t|rdSt|}t|dot|d S)aReturn true if the object is a method descriptor. But not if ismethod() or isclass() or isfunction() are true. This is new in Python 2.2, and, for example, is true of int.__add__. An object passing this test has a __get__ attribute but not a __set__ attribute, but beyond that the set of attributes varies. __name__ is usually sensible, and __doc__ often is. Methods implemented via descriptors that also pass one of the other tests return false from the ismethoddescriptor() test, simply because the other tests promise more -- you can, e.g., count on having the __func__ attribute (etc) when an object passes ismethod().F__get____set__r;r> isfunctionrrr7tprrrismethoddescriptorsrFcCs8t|s t|s t|rdSt|}t|dpt|dS)a}Return true if the object is a data descriptor. Data descriptors have a __set__ or a __delete__ attribute. Examples are properties (defined in Python) and getsets and members (defined in C). Typically, data descriptors will also have __name__ and __doc__ attributes (properties, getsets, and members have both of these attributes), but this is not guaranteed.FrA __delete__rBrDrrrisdatadescriptorsrHMemberDescriptorTypecCr5)Return true if the object is a member descriptor. Member descriptors are specialized descriptors defined in extension modules.)rrrIr6rrrismemberdescriptor rKcCdS)rJFrr6rrrrKrcCr5)Return true if the object is a getset descriptor. getset descriptors are specialized descriptors defined in extension modules.)rrrr6rrrisgetsetdescriptorrLrPcCrM)rOFrr6rrrrPrNcCr5)a(Return true if the object is a user-defined function. Function objects provide these attributes: __doc__ documentation string __name__ name with which this function was defined __code__ code object containing compiled function bytecode __defaults__ tuple of any default values for arguments __globals__ global namespace in which this function was defined __annotations__ dict of parameter annotations __kwdefaults__ dict of keyword only parameters with defaults)rr FunctionTyper6rrrrCs rCcCsDt|r |j}t|st|}t|st|sdSt|jj|@S)zReturn true if ``f`` is a function (or a method or functools.partial wrapper wrapping a function) whose code object has the given ``flag`` set in its flags.F) r>__func__r'_unwrap_partialrC_signature_is_functionlikebool__code__co_flags)fflagrrr_has_code_flag"s rZcCr:)zReturn true if the object is a user-defined generator function. Generator function objects provide the same attributes as functions. See help(isfunction) for a list of attributes.)rZ CO_GENERATORr+rrrisgeneratorfunction- r]cCr:)zuReturn true if the object is a coroutine function. Coroutine functions are defined with "async def" syntax. )rZ CO_COROUTINEr\rrriscoroutinefunction4r^r`cCr:)zReturn true if the object is an asynchronous generator function. Asynchronous generator functions are defined with "async def" syntax and have "yield" expressions in their body. )rZCO_ASYNC_GENERATORr\rrrisasyncgenfunction;r<rbcCr5)z7Return true if the object is an asynchronous generator.)rrAsyncGeneratorTyper6rrr isasyncgenC rdcCr5)aReturn true if the object is a generator. Generator objects provide these attributes: __iter__ defined to support iteration over container close raises a new GeneratorExit exception inside the generator to terminate the iteration gi_code code object gi_frame frame object or possibly None once the generator has been exhausted gi_running set to 1 when generator is executing, 0 otherwise next return the next item from the container send resumes the generator and "sends" a value that becomes the result of the current yield-expression throw used to raise an exception inside the generator)rr GeneratorTyper6rrr isgeneratorGs rgcCr5)z)Return true if the object is a coroutine.)rr CoroutineTyper6rrr iscoroutineXrericCs6t|tjpt|tjot|jjt@pt|tj j S)z?Return true if object can be passed to an ``await`` expression.) rrrhrfrUgi_coderWCO_ITERABLE_COROUTINE collectionsabc Awaitabler6rrr isawaitable\s   rocCr5)abReturn true if the object is a traceback. Traceback objects provide these attributes: tb_frame frame object at this level tb_lasti index of last attempted instruction in bytecode tb_lineno current line number in Python source code tb_next next inner traceback object (called by this level))rr TracebackTyper6rrr istracebackcr?rqcCr5)a`Return true if the object is a frame object. Frame objects provide these attributes: f_back next outer frame object (this frame's caller) f_builtins built-in namespace seen by this frame f_code code object being executed in this frame f_globals global namespace seen by this frame f_lasti index of last attempted instruction in bytecode f_lineno current line number in Python source code f_locals local namespace seen by this frame f_trace tracing function for this frame, or None)rr FrameTyper6rrrisframems rscCr5)aReturn true if the object is a code object. Code objects provide these attributes: co_argcount number of arguments (not including *, ** args or keyword only arguments) co_code string of raw compiled bytecode co_cellvars tuple of names of cell variables co_consts tuple of constants used in the bytecode co_filename name of file in which this code object was created co_firstlineno number of first line in Python source code co_flags bitmap: 1=optimized | 2=newlocals | 4=*arg | 8=**arg | 16=nested | 32=generator | 64=nofree | 128=coroutine | 256=iterable_coroutine | 512=async_generator co_freevars tuple of names of free variables co_posonlyargcount number of positional only arguments co_kwonlyargcount number of keyword only arguments (not including ** arg) co_lnotab encoded mapping of line numbers to bytecode indices co_name name with which this code object was defined co_names tuple of names other than arguments and function locals co_nlocals number of local variables co_stacksize virtual machine stack space required co_varnames tuple of names of arguments and local variables)rrCodeTyper6rrriscode{s rucCr5)a,Return true if the object is a built-in function or method. Built-in functions and methods provide these attributes: __doc__ documentation string __name__ original name of this function or method __self__ instance to which a method is bound, or None)rrBuiltinFunctionTyper6rrr isbuiltinr9rwcCs t|pt|pt|pt|S)zrFr6rrr isroutinesrxcCst|tsdS|jt@rdStt|tjsdSt|drdS|j D] \}}t |ddr1dSq$|j D]}t |ddD]}t ||d}t |ddrOdSq=q5dS)z:Return true if the object is an abstract base class (ABC).FT__abstractmethods____isabstractmethod__rN) rr __flags__TPFLAGS_IS_ABSTRACT issubclassrmABCMetarr r*r __bases__)r7namerbaserrr isabstracts(       rc Cst|r |ft|}nd}g}t}t|}z|jD]}|jD]\}}t|tj r1| |q"qWn t y=Ynw|D]>} z t || } | |vrNt Wnt yk|D]}| |jvrf|j| } nqXYq@Ynw|rr|| ry| | | f| | q@|jddd|S)zReturn all members of an object as (name, value) pairs sorted by name. Optionally, only return members that satisfy a given predicate.rcSs|dS)Nrr)pairrrrzgetmembers..r)r;getmrosetdirrr r*rrDynamicClassAttributeappendAttributeErrorraddsort) r7 predicatemroresults processednamesrkvrrrrr getmemberssJ          r Attributezname kind defining_class objectc Cs4t|}tt|}tdd|D}|f|}||}t|}|D]}|jD]\}}t|tjr=|j dur=| |q)q"g} t } |D]} d} d} d}| | vrz| dkr[t dt || } Wnt ys}zWYd}~nGd}~wwt | d| } | |vrd} d}|D]}t || d}|| ur|}q|D]}z||| }Wn tyYqw|| ur|}q|dur|} |D]}| |jvr|j| }| |vr|} nq| durqF| dur| n|}t|ttjfrd}|}n!t|ttjfrd}|}nt|trd }|}n t|rd }nd }| t| || || | qF| S) aNReturn list of attribute-descriptor tuples. For each name in dir(cls), the return list contains a 4-tuple with these elements: 0. The name (a string). 1. The kind of attribute this is, one of these strings: 'class method' created via classmethod() 'static method' created via staticmethod() 'property' created via property() 'method' any other flavor of method or descriptor 'data' not a method 2. The class which defined this attribute (a class). 3. The object as obtained by calling getattr; if this fails, or if the resulting object does not live anywhere in the class' mro (including metaclasses) then the object is looked up in the defining class's dict (found by walking the mro). If one of the items in dir(cls) is stored in the metaclass it will now be discovered and not have None be listed as the class in which it was defined. Any items whose home class cannot be discovered are skipped. css |] }|ttfvr|VqdSN)rr7)rclsrrr sz'classify_class_attrs..Nr z)__dict__ is special, don't want the proxy __objclass__z static methodz class methodpropertymethoddata)rrtuplerr r*rrrfgetrr Exceptionr __getattr__r staticmethodBuiltinMethodType classmethodClassMethodDescriptorTyperrxrr)rrmetamro class_bases all_basesrrrrresultrrhomeclsget_objdict_objexclast_clssrch_clssrch_objr+kindrrrclassify_class_attrss             rcC|jS)zHReturn tuple of base classes (including cls) in method resolution order.)__mro__)rrrrr^rstopcsdur dd}nfdd}|}t||i}t}||r?|j}t|}||vs0t||kr7td||||<||s|S)anGet the object wrapped by *func*. Follows the chain of :attr:`__wrapped__` attributes returning the last object in the chain. *stop* is an optional callback accepting an object in the wrapper chain as its sole argument that allows the unwrapping to be terminated early if the callback returns a true value. If the callback never returns a true value, the last object in the chain is returned as usual. For example, :func:`signature` uses this to stop unwrapping if any object in the chain has a ``__signature__`` attribute defined. :exc:`ValueError` is raised if a cycle is encountered. NcSs t|dSNrrrXrrr _is_wrapperu zunwrap.._is_wrappercst|do | Srrrrrrrxsz!wrapper loop when unwrapping {!r})idrgetrecursionlimitrlenr&format)r)rrrXmemorecursion_limitid_funcrrrr2ds   r2cCs|}t|t|S)zBReturn the indent size, in spaces, at the start of a line of text.) expandtabsrlstrip)lineexplinerrr indentsizesrcCsNtj|j}|dur dS|jdddD]}t||}qt|s%dS|S)N.)rr r r __qualname__splitrr;)r)rrrrr _findclasss rc Cst|r'|jD]}|tur$z|j}Wn tyYqw|dur$|SqdSt|rI|jj}|j}t|rEt t ||dd|jurE|}n|j }nt |rb|j}t |}|dus_t |||uradSnmt |r|j}|j}t|r}|jd||jkr}|}nR|j }nNt|tr|j}|j}t |}|dust |||urdSn1t|st|r|j}|j}t |||urdSt|rt |dd}t|tr||vr||SndS|jD]}zt ||j}Wn tyYqw|dur|SqdS)NrRr __slots__)r;rr7__doc__rr>rR__name____self__r __class__rCrrwrrrrrFrHrrKr!)r+rdocrselfrr)slotsrrr_finddocsx       rc Csdz|j}Wn tyYdSw|dur'zt|}Wn ttfy&YdSwt|ts.dSt|S)zGet the documentation string for an object. All tabs are expanded to spaces. To clean up docstrings that are indented to line up with blocks of code, any whitespace than can be uniformly removed from the second line onwards is removed.N)rrrr%rrcleandoc)r7rrrrgetdocs    rcCsz |d}Wn tyYdSwtj}|ddD]}t|}|r2t||}t||}q|r=|d|d<|tjkrVtdt|D] }|||d||<qI|rf|dsf| |rf|dr\|rw|dsw| d|rw|drld |S)zClean up indentation from docstrings. Any whitespace that can be uniformly removed from the second line onwards is removed. Nrr) rr UnicodeErrorrmaxsizerrminrangepopjoin)rlinesmarginrcontentindentirrrrs.     (    rcCst|rt|ddr |jStd|t|r=t|dr6tj |j }t|ddr-|jS|j dkr6t dtd|t |rD|j }t|rK|j}t|rR|j}t|rY|j}t|r`|jStdt|j) z@Work out which source or compiled file an object was defined in.__file__Nz{!r} is a built-in moduler __main__source code not availablez{!r} is a built-in classzVmodule, class, method, function, traceback, frame, or code object was expected, got {})r8rrr%rr;rrr r r OSErrorr>rRrCrVrqtb_framersf_coderu co_filenamerr)r7r0rrrgetfiles6    rcCsTtj|}ddtjD}||D]\}}||r'|d|SqdS)z1Return the module name for a given file, or None.cSsg|] }t| |fqSr)r)rsuffixrrr %sz!getmodulename..N)ospathbasename importlib machinery all_suffixesrendswith)rfnamesuffixesneglenrrrr getmodulename!s   rcst|tjjdd}|tjjdd7}tfdd|Dr0tjdtjj dntfddtjj Dr?dStj rGSt |}t |dddurVSt t |dddddurdStjvrkSdS) zReturn the filename that can be used to locate an object's source. Return None if no way can be identified to get the source. Nc3|]}|VqdSrrrsfilenamerrr4z getsourcefile..rc3rrrrrrrr7r __loader____spec__loader)rrrDEBUG_BYTECODE_SUFFIXESOPTIMIZED_BYTECODE_SUFFIXESanyrrsplitextSOURCE_SUFFIXESEXTENSION_SUFFIXESexists getmoduler linecachecache)r7all_bytecode_suffixesr0rrr getsourcefile-s*     rcCs,|dur t|p t|}tjtj|S)zReturn an absolute path to the source or compiled file for an object. The idea is for each object to have a unique origin, so this routine normalizes the result as much as possible.N)rrrrnormcaseabspath)r7 _filenamerrr getabsfileFsrc Cszt|r|St|drtj|jS|dur"|tvr"tjt|Szt||}Wn tt fy5YdSw|tvrBtjt|Stj D].\}}t|rwt|drw|j }|t |dkrbqI|t |<t|}|jt|<ttj|<qI|tvrtjt|Stjd}t|dsdSt||jrt||j}||ur|Stjd}t||jrt||j} | |ur|SdSdS)zAReturn the module an object was defined in, or None if not found.r Nrrrbuiltins)r8rrr r r modulesbyfilerr%FileNotFoundErrorcopyr*r_filesbymodnamerrrrealpathr) r7rfilemodnamer0rXmain mainobjectbuiltin builtinobjectrrrr RsR         r c@ eZdZdS)ClassFoundExceptionNrr rrrrrr#sr#c@s(eZdZddZddZeZddZdS) _ClassFindercCsg|_||_dSr)stackqualname)rr'rrr__init__ z_ClassFinder.__init__cCs<|j|j|jd|||j|jdS)Nz)r&rr generic_visitrrnoderrrvisit_FunctionDefs    z_ClassFinder.visit_FunctionDefcCsb|j|j|jd|jkr%|jr|jdj}n|j}|d8}t||||j dS)Nrrr) r&rrr'rdecorator_listlinenor#r*r)rr, line_numberrrrvisit_ClassDefs z_ClassFinder.visit_ClassDefN)rr rr(r-visit_AsyncFunctionDefr1rrrrr%s  r%c Cst|}|r t|nt|}|dr|dstdt||}|r-t||j }nt|}|s8tdt |r@|dfSt |r{|j }d |}t|}t|}z ||Wtdtyz}z|jd} || fWYd}~Sd}~wwt|r|j}t|r|j}t|r|j}t|r|j}t|rt|d std |jd } t d } | dkrz|| } Wn t!ytd w| "| r || fS| d } | dks|| fStd)abReturn the entire source file and starting line number for an object. The argument may be a module, class, method, function, traceback, frame, or code object. The source code is returned as a list of all the lines in the file and the line number indexes a line in that list. An OSError is raised if the source code cannot be retrieved.<>rzcould not get source coderNzcould not find class definitionco_firstlinenoz"could not find function definitionrz>^(\s*def\s)|(\s*async\s+def\s)|(.*(?rRrCrVrqrrsrrurr6recompile IndexErrormatch) r7rr0rr'sourcetree class_finderer0lnumpatrrrr findsourcesj             rHc Cszt|\}}Wn ttfyYdSwt|rd}|r)|ddddkr)d}|t|krI||dvrI|d}|t|krI||dvs7|t|kr||dddkrg}|}|t|kr||dddkr||||d}|t|kr||dddksmd|SdSdS|dkrSt ||}|d}|dkrU|| dddkrWt |||krY|| g}|dkr|d}|| }|dddkrt |||kr|g|dd<|d}|dkrn|| }|dddkrt |||ks|r0|ddkr0g|dd<|r0|ddks|rN|d dkrNg|d d<|rN|d dksrNr) r2rHrqrr8rsrco_namerpr7rrFrrrgetsourcelinesXs  rscCst|\}}d|S)aReturn the text of the source code for an object. The argument may be a module, class, method, function, traceback, frame, or code object. The source code is returned as a single string. An OSError is raised if the source code cannot be retrieved.r5)rsrrrrrr getsourcems  rtcCsRg}|jtddd|D]}|||jf||vr&|t||||q |S)z-Recursive helper function for getclasstree().r rr)rrrrwalktree)classeschildrenparentrcrrrruwsrucCsi}g}|D]2}|jr/|jD]}||vrg||<|||vr%||||r-||vr-nqq||vr8||q|D] }||vrF||q;t||dS)aArrange the given list of classes into a hierarchy of nested lists. Where a nested list appears, it contains classes derived from the class whose entry immediately precedes the list. Each entry is a 2-tuple containing a class and a tuple of its base classes. If the 'unique' argument is true, exactly one entry appears in the returned structure for each class in the given list. Otherwise, classes using multiple inheritance and their descendants will appear multiple times.N)rrru)rvuniquerwrootsryrxrrr getclasstrees&      r| Argumentszargs, varargs, varkwc Cst|s td||j}|j}|j}t|d|}t||||}d}||7}d}|jt@r<|j|}|d}d}|jt @rH|j|}t ||||S)aGet information about the arguments accepted by a code object. Three things are returned: (args, varargs, varkw), where 'args' is the list of argument names. Keyword-only arguments are appended. 'varargs' and 'varkw' are the names of the * and ** arguments or None.z{!r} is not a code objectNrr) rur%r co_varnames co_argcountco_kwonlyargcountlistrW CO_VARARGSCO_VARKEYWORDSr}) cornargsnkwargsr= kwonlyargsstepvarargsvarkwrrrgetargss"    rArgSpeczargs varargs keywords defaultscCsDtjdtddt|\}}}}}}}|s|rtdt||||S)aeGet the names and default values of a function's parameters. A tuple of four things is returned: (args, varargs, keywords, defaults). 'args' is a list of the argument names, including keyword-only argument names. 'varargs' and 'keywords' are the names of the * and ** parameters or None. 'defaults' is an n-tuple of the default values of the last n parameters. This function is deprecated, as it does not support annotations or keyword-only parameters and will raise ValueError if either is present on the supplied callable. For a more structured introspection API, use inspect.signature() instead. Alternatively, use getfullargspec() for an API with a similar namedtuple based interface, but full support for annotations and keyword-only parameters. Deprecated since Python 3.5, use `inspect.getfullargspec()`. zhinspect.getargspec() is deprecated since Python 3.0, use inspect.signature() or inspect.getfullargspec()rI stacklevelzgFunction has keyword-only parameters or annotations, use inspect.signature() API which can support them)warningswarnDeprecationWarninggetfullargspecr&r)r)r=rrdefaultsrkwonlydefaultsr-rrr getargspecsr FullArgSpeczGargs, varargs, varkw, defaults, kwonlyargs, kwonlydefaults, annotationsc Csfz t|ddtdd}Wnty}ztd|d}~wwg}d}d}g}g}i}d} i} |j|jur8|j|d<|jD]a} | j} | j } | t ur[| | | j | jurZ| | j f7} n8| t urq| | | j | jurp| | j f7} n"| turx| }n| tur| | | j | jur| j | | <n| tur| }| j| jur| j|| <q=| sd} | sd} t||||| || |S)a$Get the names and default values of a callable object's parameters. A tuple of seven things is returned: (args, varargs, varkw, defaults, kwonlyargs, kwonlydefaults, annotations). 'args' is a list of the parameter names. 'varargs' and 'varkw' are the names of the * and ** parameters or None. 'defaults' is an n-tuple of the default values of the last n parameters. 'kwonlyargs' is a list of keyword-only parameter names. 'kwonlydefaults' is a dictionary mapping names from kwonlyargs to defaults. 'annotations' is a dictionary mapping parameter names to annotations. Notable differences from inspect.signature(): - the "self" parameter is always reported, even for bound methods - wrapper chains defined by __wrapped__ *not* unwrapped automatically F)follow_wrapper_chainsskip_bound_argsigclsr zunsupported callableNrreturn)_signature_from_callable Signaturerr%return_annotationempty parametersvaluesrr_POSITIONAL_ONLYrdefault_POSITIONAL_OR_KEYWORD_VAR_POSITIONAL _KEYWORD_ONLY _VAR_KEYWORD annotationr)r)sigexr=rr posonlyargsr annotationsr kwdefaultsparamrrrrrrsj               rArgInfozargs varargs keywords localscCs t|j\}}}t||||jS)a9Get information about arguments passed into a particular frame. A tuple of four things is returned: (args, varargs, varkw, locals). 'args' is a list of the argument names. 'varargs' and 'varkw' are the names of the * and ** arguments or None. 'locals' is the locals dictionary of the given frame.)rrrf_locals)framer=rrrrr getargvalues;srcCstt|dddkrdd}td|t|St|tjrt|St|tr6|j d|fvr.|j S|j d|j St|S)Nr typingcSs|}|dS)Nztyping.)group removeprefix)rAtextrrrreplGs zformatannotation..replz[\w\.]+rr) rr>subreprrr GenericAliasrrr r)r base_modulerrrrformatannotationEs  rcst|ddfdd}|S)Nr cs t|Sr)r)rr0rr_formatannotationUrz5formatannotationrelativeto.._formatannotation)r)r7rrrrformatannotationrelativetoSs  rrcCd|SN*rrrrrr\rrcCrN**rrrrrr]rcC dt|SN=rrrrrr^rRcCr)Nz -> r)rrrrr_rc s8ddlm} | dtddfdd}g}|r!t|t|}t|D]\}}||}|r=||kr=|| |||}||q%|durQ||||n|rX|d |rv|D]}||}|rp||vrp|| ||7}||q\|dur|| ||d d |d }d vr|| d 7}|S)aFormat an argument spec from the values returned by getfullargspec. The first seven arguments are (args, varargs, varkw, defaults, kwonlyargs, kwonlydefaults, annotations). The other five arguments are the corresponding optional formatting functions that are called to turn names and values into strings. The last argument is an optional function to format the sequence of arguments. Deprecated since Python 3.5: use the `signature` function and `Signature` objects. r)rzc`formatargspec` is deprecated since Python 3.5. Use `signature` and the `Signature` object directlyrIrcs(|}|vr|d|7}|S)Nz: r)argrrr formatargrrformatargandannotationtsz-formatargspec..formatargandannotationNr(, )r)rrrr enumeraterr)r=rrrrrrr formatvarargs formatvarkw formatvalue formatreturnsrrrspecs firstdefaultrrspec kwonlyargrrrr formatargspecYs<      rcCrrrrrrrrrcCrrrrrrrrrcCrrrrrrrrrRc Cs|||fdd}g} tt|D] } | ||| q|r+| ||||||r:| |||||dd| dS)afFormat an argument spec from the 4 values returned by getargvalues. The first four arguments are (args, varargs, varkw, locals). The next four arguments are the corresponding optional formatting functions that are called to turn names and values into strings. The ninth argument is an optional function to format the sequence of arguments.cSs|||||Srr)rrrrrrrconvertsz formatargvalues..convertrrr)rrrr) r=rrrrrrrrrrrrrformatargvaluess  rcsfdd|D}t|}|dkr|d}n|dkr dj|}ndj|dd}|dd=d ||}td |||r=d nd |dkrDd nd|f)Ncsg|] }|vrt|qSrr)rrrrrrsz&_missing_arguments..rrrIz {} and {}z , {} and {}rz*%s() missing %i required %s argument%s: %s positional keyword-onlyr5r)rrrr%)f_nameargnamesposrrmissingrtailrrr_missing_argumentss    rc st||}tfdd|D}|r|dk} d|f} n|r*d} d|t|f} n t|dk} tt|} d} |rOd} | |dkrCd nd||dkrKd ndf} td || | rWd nd|| |dkre|sed fd f) Ncsg|]}|vr|qSrr)rrrrrrsz_too_many..rz at least %dTz from %d to %dr5z7 positional argument%s (and %d keyword-only argument%s)rz5%s() takes %s positional argument%s but %d%s %s givenwaswere)rrr%) rr=kwonlyrdefcountgivenratleast kwonly_givenpluralr kwonly_sigmsgrrr _too_manys0    rcOst|}|\}}}}}} } |j} i} t|r!|jdur!|jf|}t|} t|}|r/t|nd}t| |}t|D] }||| ||<q:|rQt||d| |<t||}|r]i| |<| D])\}}||vrz|sst d| |f|| ||<qa|| vrt d| |f|| |<qa| |kr|st | ||||| | | |kr|d||}|D] }|| vrt | |d| qt |||dD]\}}|| vr||| |<qd}|D]}|| vr| r|| vr| || |<q|d7}q|rt | |d| | S)zGet the mapping of arguments to values. A dict is returned, with keys the function argument names (including the names of the * and ** arguments, if any), and values the respective bound values from 'positional' and 'named'.Nrz*%s() got an unexpected keyword argument %rz(%s() got multiple values for argument %rTrF)rrr>rrrrrrr*r%rrr)r)rnamedrr=rrrrrr-r arg2valuenum_posnum_args num_defaultsnrpossible_kwargskwrreqrrkwargrrr getcallargssl          r ClosureVarsz"nonlocals globals builtins unboundc Cst|r|j}t|std||j}|jduri}n ddt|j|jD}|j }| dt j }t |r:|j }i}i}t}|jD]/}|dvrKqDz||||<WqDtysz||||<Wntyp||YnwYqDwt||||S)a Get the mapping of free variables to their current values. Returns a named tuple of dicts mapping the current nonlocal, global and builtin references as seen by the body of the function. A final set of unbound names that could not be resolved is also provided. {!r} is not a Python functionNcSsi|]\}}||jqSr) cell_contents)rvarcellrrrr"sz"getclosurevars.. __builtins__)NoneTrueFalse)r>rRrCr%rrV __closure__zip co_freevarsrr rr r8rco_namesKeyErrorrr) r)code nonlocal_vars global_ns builtin_ns global_vars builtin_vars unbound_namesrrrrgetclosurevars sB      r Tracebackz+filename lineno function code_context indexrcCst|r |j}|j}n|j}t|std|t|p t|}|dkr^|d|d}zt |\}}Wn t yBd}}Yn wt dt |t ||}||||}|d|}nd}}t|||jj||S)aGet information about a frame or traceback object. A tuple of five things is returned: the filename, the line number of the current line, the function name, a list of lines of context from the source code, and the index of the current line within that list. The optional second argument specifies the number of lines of context to return, which are centered around the current line.z'{!r} is not a frame or traceback objectrrrIN)rq tb_linenorf_linenorsr%rrrrHrmaxrrrrrq)rcontextr/rrLrrFindexrrr getframeinfoDs&  rcCr)zCGet the line number from a frame object, allowing for optimization.)rrrrr getlinenodsr FrameInforcCs4g}|r|ft||}|t||j}|s|S)zGet a list of records for a frame and all higher (calling) frames. Each record contains a frame object, filename, line number, function name, a list of lines of context, and index within the context.)rrrf_back)rr framelist frameinforrrgetouterframesksr cCs6g}|r|jft||}|t||j}|s|S)zGet a list of records for a traceback's frame and all lower frames. Each record contains a frame object, filename, line number, function name, a list of lines of context, and index within the context.)rrrrtb_next)tbrrrrrrgetinnerframeswsr#cCsttdr tdSdS)z?Return the frame of the caller or None if this is not possible. _getframerN)rrr$rrrr currentframesr%cCsttd|S)z@Return a list of records for the stack above the caller's frame.r)r rr$rrrrr&sr&cCsttd|S)zCReturn a list of records for the stack below the current exception.rI)r#rexc_infor&rrrtracesr(cCstjd|S)Nr)rr r@)klassrrr_static_getmror*cCs6i}zt|d}Wn tyYnwt||tSNr )r7__getattribute__rr!r _sentinel)r+attr instance_dictrrr_check_instances r1c CsFt|D]}tt|tur z|j|WStyYqwqtSr)r*_shadowed_dictrr.r r )r)r/entryrrr _check_classs  r4cCs$zt|WdStyYdSwNFT)r*r%r\rrr_is_types   r6c Csltjd}t|D]*}z ||d}Wn tyYq wt|tjur/|jdkr/|j|us3|Sq t Sr,) rr r*r@r rrrrr.)r) dict_attrr3 class_dictrrrr2s     r2c Cst}t|st|}t|}|tust|tjurt||}n|}t||}|turB|turBtt|dturBtt|dturB|S|turH|S|turN|S||urutt|D]}tt|turtz|j |WSt ysYqXwqX|tur{|St |)aRetrieve attributes without triggering dynamic lookup via the descriptor protocol, __getattr__ or __getattribute__. Note: this function may not be able to retrieve all attributes that getattr can fetch (like dynamically created attributes) and may find attributes that getattr can't (like descriptors that raise AttributeError). It can also return descriptor objects instead of instance members in some cases. See the documentation for details. r@rA) r.r6rr2rrIr1r4r*r r r)r+r/rinstance_resultr)r7 klass_resultr3rrrgetattr_statics<    r; GEN_CREATED GEN_RUNNING GEN_SUSPENDED GEN_CLOSEDcC,|jrtS|jdur tS|jjdkrtStS)a#Get current state of a generator-iterator. Possible states are: GEN_CREATED: Waiting to start execution. GEN_RUNNING: Currently being executed by the interpreter. GEN_SUSPENDED: Currently suspended at a yield expression. GEN_CLOSED: Execution has completed. Nr) gi_runningr=gi_framer?f_lastir<r>) generatorrrrgetgeneratorstate   rEcCs6t|s td|t|dd}|dur|jjSiS)z Get the mapping of generator local variables to their current values. A dict is returned, with the keys the local variable names and values the bound values.z{!r} is not a Python generatorrBN)rgr%rrrBr)rDrrrrgetgeneratorlocalss  rG CORO_CREATED CORO_RUNNINGCORO_SUSPENDED CORO_CLOSEDcCr@)a&Get current state of a coroutine object. Possible states are: CORO_CREATED: Waiting to start execution. CORO_RUNNING: Currently being executed by the interpreter. CORO_SUSPENDED: Currently suspended at an await expression. CORO_CLOSED: Execution has completed. Nr) cr_runningrIcr_framerKrCrHrJ) coroutinerrrgetcoroutinestaterFrOcCst|dd}|dur |jSiS)z Get the mapping of coroutine local variables to their current values. A dict is returned, with the keys the local variable names and values the bound values.rMN)rr)rNrrrrgetcoroutinelocals/s rP from_bytescCs6zt||}Wn tyYdSwt|ts|SdS)zPrivate helper. Checks if ``cls`` has an attribute named ``method_name`` and returns it only if it is a pure python function. N)rrr_NonUserDefinedCallables)r method_namemethrrr"_signature_get_user_defined_methodKs  rUc Cs|j}t|}|jp d}|jpi}|r||}z |j|i|}Wnty9}z d|} t| |d}~wwd} |D]\} } z|j | } Wn t yTYn4w| j t ur`| | q@| j tur{| |vrtd} | j| d|| <n| | jq@| j tur| j| d|| <| r| j t usJ| j tur|| jtd}||| <|| q@| j ttfvr|| q@| j tur| | jq@|j|dS) zPrivate helper to calculate how 'wrapped_sig' signature will look like after applying a 'functools.partial' object (or alike) on it. rz+partial object {!r} has incorrect argumentsNFT)rrr)rrr*r=keywords bind_partialr%rr& argumentsr rrrrreplacerr move_to_endrrr) wrapped_sigr( extra_args old_params new_params partial_argspartial_keywordsbarrtransform_to_kwonly param_namer arg_value new_paramrrr_signature_get_partial[sV                 rhcCslt|j}|r|djttfvrtd|dj}|ttfvr(|dd}n|t ur0td|j |dS)zWPrivate helper to transform signatures for unbound functions to bound methods. rzinvalid method signaturerNzinvalid argument typerW) rrrrrrr&rrrr[)rparamsrrrr_signature_bound_methods   rjcCs&t|pt|pt|tp|ttfvS)zxPrivate helper to test if `obj` is a callable that might support Argument Clinic's __text_signature__ protocol. )rwrFrrRrr7r\rrr_signature_is_builtins rkcCst|rt|r dSt|dd}t|dd}t|dt}t|dt}t|dd}t|tjoMt|toM|dup;t|toM|dupDt|t oMt|t pM|duS)zPrivate helper to test if `obj` is a duck type of FunctionType. A good example of such objects are functions compiled with Cython, which have all attributes that a pure Python function would have, but have their code statically compiled. FrNrV __defaults____kwdefaults__r ) r$r;r_voidrrrtrrr!)r+rr rrrrrrrTs       rTcCsr|dsJ|d}|dkr|d}|d}|dks$||ks$J|d}|dks3||ks3J|d|S)z Private helper to get first parameter name from a __text_signature__ of a builtin method, which should be in the following format: '($param1, ...)'. Assumptions are that the first argument won't have a default value or an annotation. z($,rr:rrI)r8find)rrcposrrr_signature_get_bound_params     rscCsX|s|ddfSd}d}dd|dD}t|j}t|}d}d}g}|j} d} tj} tj} t|} | j tj ks|d krt|rgJ|dusmJd}| d }q>|| kr|d kr|dusJ| }q>|rd}|| kr|d ks| d | ||dkr| dq>d |}|||fS)a Private helper function. Takes a signature in Argument Clinic's extended signature format. Returns a tuple of three things: * that signature re-rendered in standard Python syntax, * the index of the "self" parameter (generally 0), or None if the function does not have a "self" parameter, and * the index of the last "positional only" parameter, or None if the signature has no positional-only parameters. NcSsg|] }|r|dqS)ascii)encode)rlrrrrsz6_signature_strip_non_python_syntax..rFrroTr/$rr r5) rrjrkr_rreOP ERRORTOKENnextrENCODINGstringr) signatureself_parameterlast_positional_onlyrrD token_stream delayed_commaskip_next_commarrcurrent_parameterrzr{trr~clean_signaturerrr"_signature_strip_non_python_syntaxs\       rTc sTddl|jt|\}}}d|d}z|}Wn ty&d}Ynwt|js4td|j d} gj d}it dd} | rVt j | d}|rV|jt j  fdd fd d  G fd d d jffd d } t| jj} t| jj} tj| | dd}|durjnjttt|D]\}\}}| ||||krjq| jjr̈j| | jjjt| jj| jj D] \}}| ||q| jj!rj"| | jj!|dur#sJt dd}|du}t#|}|r|s|r$dn dj%jd} | d<||j dS)zdPrivate helper to parse content of '__text_signature__' and return a Signature based on it. rNzdef fooz: pass"{!r} builtin has invalid signaturer cs(t|jsJ|jdurtd|jS)Nz'Annotations are not currently supported)rrrr&)r,r:rr parse_namejs z&_signature_fromstr..parse_namec slzt|}Wnty!zt|}Wn tytwYnwt|tttttt dfr4 |Str) r NameErrorr&rrintfloatbytesrUrConstant)rr)r: module_dictsys_module_dictrr wrap_valueps   z&_signature_fromstr..wrap_valuecs4eZdZfddZfddZfddZdS)z,_signature_fromstr..RewriteSymbolicscsdg}|}t|jr||j|j}t|js t|js!t||jdt |}|S)Nr) rrrr/rNamer&rrreversed)rr,arrr:rrrvisit_Attribute~s    z<_signature_fromstr..RewriteSymbolics.visit_Attributecst|jjs t|jSr)rctxLoadr&rr+rrr visit_Names z7_signature_fromstr..RewriteSymbolics.visit_Namecs||j}||j}t|jrt|jstt|jjr*|j|jSt|jj r:|j|jSt|jj rJ|j|jBStr) r<leftrightrrr&opAddrSubBitOr)rr,rrrrr visit_BinOps  z8_signature_fromstr..RewriteSymbolics.visit_BinOpN)rr rrrrrrrrRewriteSymbolics}s rcsh|}|r'|tur'z |}|}Wnty&tddw||ddS)Nrrr)_emptyr< literal_evalr&rr) name_node default_noderr) Parameterrr:rrr+rrrrps   z_signature_fromstr..p) fillvaluerrVr)&r:_parameter_clsrr; SyntaxErrorrModuler&rbodyrrrr r r rNodeTransformerrr=r itertools zip_longestPOSITIONAL_ONLYPOSITIONAL_OR_KEYWORDrrvarargVAR_POSITIONAL KEYWORD_ONLYrr kw_defaultsr VAR_KEYWORDr8rr[)rr+rrrrrprogramr0rXr/rr=rrjrrr_self self_isbound self_ismoduler) rrr:rrrr+rrrrr_signature_fromstrEsr        !      rcCsBt|s td|t|dd}|std|t||||S)zHPrivate helper function to get signature for builtin callables. z%{!r} is not a Python builtin function__text_signature__Nz#no signature found for builtin {!r})rkr%rrr&r)rr)rrrrr_signature_from_builtins rc CsFd}t|st|r d}ntd|t|dd}|r#t||||S|j}|j} | j} | j } | j } | d| } | j }| | | |}t ||||d}|j }|j}|rXt|}nd}g}| |}| }| d|D]}|rntnt}||t}|||||d|r|d 8}qht| |dD]#\}}|rtnt}||t}|||||||d |r|d 8}q| jt@r| | |}||t}||||td|D]}t}|dur||t}||t}||||t|d q| jt@r| |}| jt@r|d 7}| |}||t}||||td|||d t|d S) zCPrivate helper: constructs Signature for the given python function.FTrrNrr)rrr)rrrrr__validate_parameters__)rCrTr%rrrrrVrr~co_posonlyargcountrr4rlrmrrrr rrrrWrrrrr)rr)rrrr is_duck_functionrr func_code pos_count arg_names posonly_countrkeyword_only_count keyword_onlyrrrpos_default_countrnon_default_count posonly_leftrrroffsetrrrrr_signature_from_functions                     r)rrrrr c Cstjt||||||d}t|std|t|tjr*||j }|r(t |S|S|r>t |ddd}t|tjr>||Sz|j }Wn t yLYnw|dur_t|ts]td||Sz|j} Wn t ymYn?wt| tjr|| j} t| | d}t| jd } | jtjur|St|j} | r| | d usJ| f| } |j| d St|st|rt||||||d St|rt|||d St|tjr||j} t| |Sd}t|trtt t|d }|dur||}n6d}t |d}t |d}d|j!vr|}nd|j!vr|}n|dur|}n|dur|}|dur'||}|durs|j"ddD]}z|j#}Wn t yEYq3w|rQt$|||Sq3t|j"vrs|j%t&j%url|j't&j'url|(t&St)d|n0t|t*st t|d }|durz||}Wnt)y}z d|}t)||d}~ww|dur|rt |S|St|tj+rd|}t)|t)d|)zQPrivate helper function to get signature for arbitrary callable objects. )rrrrrr z{!r} is not a callable objectcSst|dp t|tjS)N __signature__)rrrr=rrrrrl s z*_signature_from_callable..rNz1unexpected object {!r} in __signature__ attributerrrW)rrrr )r__call____new__r(rz(no signature found for builtin type {!r}zno signature found for {!r}z,no signature found for builtin function {!r}z+callable {!r} is not supported by signature),r'r(rr$r%rrrr=rRrjr2rrr_partialmethod partialmethodr)rhrrrrrrr[rCrTrrkrrrUr rrrr(r7r from_callabler&rRrv)r+rrrrr r_get_signature_ofrrr]first_wrapped_param sig_paramsr`callfactory_methodnewinitrtext_sigrrrrrrG s                                      rc@eZdZdZdS)rnz1A private marker - used in Parameter & Signature.Nrr rrrrrrrn rnc@r)rz6Marker object for Signature.empty and Parameter.empty.Nrrrrrr rrc@s4eZdZdZdZdZdZdZddZe dd Z d S) _ParameterKindrrrIcCrr)_name_rZrrr__str__ sz_ParameterKind.__str__cCst|Sr)_PARAM_NAME_MAPPINGrZrrr description sz_ParameterKind.descriptionN) rr rrrrrrrrrrrrrr srzpositional-onlyzpositional or keywordzvariadic positionalrzvariadic keywordc@seZdZdZdZeZeZe Z e Z e ZeZeedddZddZdd Zed d Zed d ZeddZeddZeeeedddZddZddZddZddZdS)raRepresents a parameter in a function signature. Has the following public attributes: * name : str The name of the parameter as a string. * default : object The default value for the parameter if specified. If the parameter has no default value, this attribute is set to `Parameter.empty`. * annotation The annotation for the parameter if specified. If the parameter has no annotation, this attribute is set to `Parameter.empty`. * kind : str Describes how argument values are bound to the parameter. Possible values: `Parameter.POSITIONAL_ONLY`, `Parameter.POSITIONAL_OR_KEYWORD`, `Parameter.VAR_POSITIONAL`, `Parameter.KEYWORD_ONLY`, `Parameter.VAR_KEYWORD`. )_name_kind_default _annotationrcCszt||_Wntytd|dw|tur/|jttfvr/d}||jj}t|||_||_ |tur=tdt |t sNdt |j }t||ddkrz|ddrz|jtkrnd }||jj}t|t|_d |dd}|std |||_dS) Nzvalue z is not a valid Parameter.kindz({} parameters cannot have default valuesz*name is a required attribute for Parameterzname must be a str, not a {}rrrzLimplicit arguments must be passed as positional or keyword arguments, not {}z implicit{}z"{!r} is not a valid parameter name)rrr&rrrrrrrrrrrr%isdigitrr isidentifierr)rrrrrrrrrr(M s8    zParameter.__init__cCs t||j|jf|j|jdfS)Nrr)rrrrrrZrrr __reduce__u s  zParameter.__reduce__cC|d|_|d|_dS)Nrrrrstaterrr __setstate__{  zParameter.__setstate__cCrr)rrZrrrr rzParameter.namecCrr)rrZrrrr rzParameter.defaultcCrr)rrZrrrr rzParameter.annotationcCrr)rrZrrrr rzParameter.kind)rrrrcCsL|tur|j}|tur|j}|tur|j}|tur|j}t|||||dS)z+Creates a customized copy of the Parameter.r)rnrrrrr)rrrrrrrrr[ szParameter.replacecCs|j}|j}|jturd|t|j}|jtur1|jtur(d|t|j}n d|t|j}|tkr;d|}|S|t krCd|}|S)Nz{}: {}z{} = {}z{}={}rr) rrrrrrrrrr)rr formattedrrrr s    zParameter.__str__cCd|jj|S)Nz <{} "{}">rrrrZrrr__repr__ r+zParameter.__repr__cCst|j|j|j|jfSr)hashrrrrrZrrr__hash__ szParameter.__hash__cCsJ||urdSt|ts tS|j|jko$|j|jko$|j|jko$|j|jkSNT)rrNotImplementedrrrrrotherrrr__eq__ s     zParameter.__eq__N)rr rrrrrrrrrrrrrrrr(rrrrrrrrnr[rrrrrrrrr- s6(      rc@sheZdZdZdZddZeddZeddZed d Z d d Z d dZ ddZ ddZ ddZdS)BoundArgumentsaResult of `Signature.bind` call. Holds the mapping of arguments to the function's parameters. Has the following public attributes: * arguments : dict An ordered mutable mapping of parameters' names to arguments' values. Does not contain arguments' default values. * signature : Signature The Signature object that created this instance. * args : tuple Tuple of positional arguments values. * kwargs : dict Dict of keyword arguments values. )rZ _signature __weakref__cCs||_||_dSr)rZr)rrrZrrrr( r)zBoundArguments.__init__cCrr)rrZrrrr rzBoundArguments.signaturec Csg}|jjD]5\}}|jttfvrt |Sz|j|}Wn ty,Yt |Sw|jtkr8| |q| |qt |Sr) rrr*rrrrZr rextendrr)rr=rerrrrrr= s     zBoundArguments.argsc Csi}d}|jjD];\}}|s"|jttfvrd}n||jvr"d}q |s%q z|j|}Wn ty5Yq w|jtkrA||q |||<q |Sr5) rrr*rrrrZr update)rkwargskwargs_startedrerrrrrr s(     zBoundArguments.kwargsc Cs|j}g}|jjD]:\}}z ||||fWq tyE|jtur*|j}n|jt ur2d}n |jt ur:i}nYq |||fYq wt ||_dS)zSet default values for missing arguments. For variable-positional arguments (*args) the default is an empty tuple. For variable-keyword arguments (**kwargs) the default is an empty dict. rN) rZrrr*rr rrrrrr!)rrZ new_argumentsrrvalrrrapply_defaults s       zBoundArguments.apply_defaultscCs2||urdSt|ts tS|j|jko|j|jkSr)rrrrrZrrrrr4 s   zBoundArguments.__eq__cCr)NrrZrrZrrrrr< rzBoundArguments.__setstate__cCs|j|jdS)Nr r rZrrr __getstate__@ zBoundArguments.__getstate__cCs@g}|jD] \}}|d||qd|jjd|S)Nz{}={!r}z <{} ({})>r)rZr*rrrrr)rr=rrrrrrC szBoundArguments.__repr__N)rr rrrr(rrr=rr rrr rrrrrr s    rc@seZdZdZdZeZeZe Z d,e ddddZ e dd Z e d d Ze dddd d ddZeddZeddZeedddZddZddZddZd dddZd d!Zd"d#Zd$d%Zd&d'Zd(d)Zd*d+ZdS)-raA Signature object represents the overall signature of a function. It stores a Parameter object for each parameter accepted by the function, as well as information specific to the function itself. A Signature object has the following public attributes and methods: * parameters : OrderedDict An ordered mapping of parameters' names to the corresponding Parameter objects (keyword-only arguments are in the same order as listed in `code.co_varnames`). * return_annotation : object The annotation for the return type of the function if specified. If the function has no annotation for its return type, this attribute is set to `Signature.empty`. * bind(*args, **kwargs) -> BoundArguments Creates a mapping from positional and keyword arguments to parameters. * bind_partial(*args, **kwargs) -> BoundArguments Creates a partial mapping from positional and keyword arguments to parameters (simulating 'functools.partial' behavior.) )_return_annotation _parametersNTrc Cs|durt}n_|r^t}t}d}|D]I}|j}|j} ||kr-d} | |j|j} t| ||kr5d}|}|ttfvrK|jt urI|rHd} t| nd}| |vrXd| } t| ||| <qn tdd|D}t ||_ ||_ dS) zConstructs Signature from the given list of Parameter objects and 'return_annotation'. All arguments are optional. NFz7wrong parameter order: {} parameter before {} parameterz-non-default argument follows default argumentTzduplicate parameter name: {!r}css|]}|j|fVqdSrrrrrrrr rz%Signature.__init__..)rrrrrrr&rrrrMappingProxyTyperr) rrrrritop_kind kind_defaultsrrrrrrrr(h sD     #  zSignature.__init__cCtjdtddt||S)zConstructs Signature for the given python function. Deprecated since Python 3.5, use `Signature.from_callable()`. z_inspect.Signature.from_function() is deprecated since Python 3.5, use Signature.from_callable()rIr)rrrrrr)rrr from_function  zSignature.from_functioncCr)zConstructs Signature for the given builtin function. Deprecated since Python 3.5, use `Signature.from_callable()`. z^inspect.Signature.from_builtin() is deprecated since Python 3.5, use Signature.from_callable()rIr)rrrrrrrr from_builtin rzSignature.from_builtinFfollow_wrappedrrr cCst||||||dS)z3Constructs Signature for the given callable object.)rrrrr )r)rr+rrrr rrrr szSignature.from_callablecCrr)rrZrrrr rzSignature.parameterscCrrrrZrrrr rzSignature.return_annotation)rrcCs0|tur |j}|tur|j}t|||dS)zCreates a customized copy of the Signature. Pass 'parameters' and/or 'return_annotation' arguments to override them in the new copy. r)rnrrrr)rrrrrrr[ s zSignature.replacecCs8tdd|jD}dd|jD}|||jfS)Ncss|] }|jtkr|VqdSr)rrrrrrr s  z(Signature._hash_basis..cSsi|] }|jtkr|j|qSr)rrrrrrrr s z)Signature._hash_basis..)rrrr)rri kwo_paramsrrr _hash_basis s zSignature._hash_basiscCs(|\}}}t|}t|||fSr)r frozensetrr)rrirrrrrr s zSignature.__hash__cCs*||urdSt|ts tS||kSr)rrrrrrrrr s  zSignature.__eq__r(c Cs|i}t|j}d}t|} zt|}Wn`tyvzt|} Wn ty-YYnw| jtkr5Yn| j|vrR| jtkrMd} | j | jd} t | d| f}Yns| jt ks\| j t ura| f}Ynd|rh| f}Yn]d} | j | jd} t | dwzt|} Wn tyt ddw| jt tfvrt dd| jtkr|g} | |t| || j<n| j|vr| jtkrt dj | jdd||| j<qd} t||D]P} | jt kr| } q| jtkrq| j} z|| }Wn"ty |s| jtkr| j t urt dj | ddYqw| jtkrt dj | jd||| <q|r8| dur,||| j<n t d j tt|d|||S) z#Private method. Don't use directly.rTzA{arg!r} parameter is positional only, but was passed as a keyword)rNz$missing a required argument: {arg!r}ztoo many positional argumentsz$multiple values for argument {arg!r}z*got an unexpected keyword argument {arg!r})rjrrr| StopIterationrrrrrr%rrrrrrrchainrr _bound_arguments_cls)rr=rr(rZr parameters_exarg_valsarg_valrrr kwargs_paramrerrr_bind s           (      J         zSignature._bindcOs |||S)zGet a BoundArguments object, that maps the passed `args` and `kwargs` to the function's signature. Raises `TypeError` if the passed arguments can not be bound. r'rr=rrrrbindm rLzSignature.bindcOs|j||ddS)zGet a BoundArguments object, that partially maps the passed `args` and `kwargs` to the function's signature. Raises `TypeError` if the passed arguments can not be bound. Trr(r)rrrrYt szSignature.bind_partialcCs t|t|jfd|jifSNr)rrrrrrZrrrr{ szSignature.__reduce__cCs|d|_dSr+rrrrrr r zSignature.__setstate__cCr)Nz<{} {}>rrZrrrr r+zSignature.__repr__c Csg}d}d}|jD]2}t|}|j}|tkrd}n |r$|dd}|tkr+d}n |tkr8|r8|dd}||q |rE|ddd |}|j t ur^t |j }|d|7}|S)NFTrwrz({})rz -> {}) rrrrrrrrrrrrr) rrrender_pos_only_separatorrender_kw_only_separatorrrrrenderedannorrrr s0       zSignature.__str__r)rr rrrrrrr"rrr(rrrrrrrrnr[rrrr'r*rYrrrrrrrrrJ s@ 6       rrcCstj|||||dS)z/Get a signature object for the passed callable.r)rr)r+rrrr rrrr src Csddl}ddl}|}|jddd|jdddd d |}|j}|d \}}}z ||}} Wn(ty\} zd |t | j | } t | t jd t dWYd} ~ nd} ~ ww|rp|d} | }| D]} t|| }qh| j t jvrt dt jd t d|jrt d |t d t| t d | j|| urt d t| jt| drt d | jnzt|\}}Wn tyYnwt d |t ddSt t|dS)z6 Logic for inspecting an object given at command line rNr7zCThe object to be analysed. It supports the 'module:qualname' syntax)helpz-dz --details store_truez9Display info about the module rather than its source code)actionr0rpzFailed to import {} ({}: {}))rrIrz#Can't get info for builtin modules.rz Target: {}z Origin: {}z Cached: {}z Loader: {}__path__zSubmodule search path: {}zLine: {}r)argparserArgumentParser add_argument parse_argsr7 partition import_modulerrrrprintrstderrexitrrbuiltin_module_namesdetailsr __cached__rrrr3rHrt)r4rparserr=targetmod_name has_attrsattrsr+r0rrpartspart__r/rrr_main sd       rHrr)F)r)r)T)TNNF)r __author__rmr:discollections.abcrlenumimportlib.machineryrrrrr>rr_rerrr'roperatorrrrrmod_dictCOMPILER_FLAG_NAMESr*rrr|r4r8r;r>rFrHrrKrPrCrZr]r`rbrdrgrirorqrsrurwrxrrrrrr2rrrrrrrrrrrr rr# NodeVisitorr%rHrPrQrSrprsrtrur|r}rrrrrrrrrrrrrrrrrrrr_fieldsrr r#r%r&r(r7r.r*r1r4r6r2r;r<r=r>r?rErGrHrIrJrKrOrPrr_WrapperDescriptorall_MethodWrapperrr _ClassMethodWrapperrvrRrUrhrjrkrTrsrrrrrrnrIntEnumrrrrrrrrrrrrrrrrrHrrrrrs  t            ,t$ >   /D-6    ]  ;  < 5         0   L  H  ` B l :